UBE2C monoclonal antibody (M04), clone 3B1
  • UBE2C monoclonal antibody (M04), clone 3B1

UBE2C monoclonal antibody (M04), clone 3B1

Ref: AB-H00011065-M04
UBE2C monoclonal antibody (M04), clone 3B1

Información del producto

Mouse monoclonal antibody raised against a full length recombinant UBE2C.
Información adicional
Size 100 ug
Gene Name UBE2C
Gene Alias UBCH10|dJ447F3.2
Gene Description ubiquitin-conjugating enzyme E2C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2C (AAH50736, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11065
Clone Number 3B1
Iso type IgG2a Kappa

Enviar un mensaje


UBE2C monoclonal antibody (M04), clone 3B1

UBE2C monoclonal antibody (M04), clone 3B1