UBE2C polyclonal antibody (A02)
  • UBE2C polyclonal antibody (A02)

UBE2C polyclonal antibody (A02)

Ref: AB-H00011065-A02
UBE2C polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant UBE2C.
Información adicional
Size 50 uL
Gene Name UBE2C
Gene Alias UBCH10|dJ447F3.2
Gene Description ubiquitin-conjugating enzyme E2C
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen UBE2C (AAH50736, 1 a.a. ~ 179 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11065

Enviar un mensaje


UBE2C polyclonal antibody (A02)

UBE2C polyclonal antibody (A02)