SOX30 purified MaxPab mouse polyclonal antibody (B01P)
  • SOX30 purified MaxPab mouse polyclonal antibody (B01P)

SOX30 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011063-B01P
SOX30 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SOX30 protein.
Información adicional
Size 50 ug
Gene Name SOX30
Gene Alias -
Gene Description SRY (sex determining region Y)-box 30
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MERARPEPPPQPRPLRPAPPPLPVEGTSFWAAAMEPPPSSPTLSAAASATLASSCGEAVASGLQPAVRRLLQVKPEQVLLLPQPQAQNEEAAASSAQARLLQFRPDLRLLQPPTASDGATSRPELHPVQPLALHVKAKKQKLGPSLDQSVGPRGAVETGPRASRVVKLEGPGPALGYFRGDEKGKLEAEEVMRDSMQGGAGKSPAAIREGVIKTEEPERLLEDCRLGAEPASNGLVHGSAEVILAPTSGAFGPHQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SOX30 (NP_008948.1, 1 a.a. ~ 501 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11063

Enviar un mensaje


SOX30 purified MaxPab mouse polyclonal antibody (B01P)

SOX30 purified MaxPab mouse polyclonal antibody (B01P)