LECT1 MaxPab rabbit polyclonal antibody (D01)
  • LECT1 MaxPab rabbit polyclonal antibody (D01)

LECT1 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00011061-D01
LECT1 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human LECT1 protein.
Información adicional
Size 100 uL
Gene Name LECT1
Gene Alias BRICD3|CHM-I|CHM1
Gene Description leukocyte cell derived chemotaxin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MTENSDKVPIALVGPDDVEFCSPPAYATLTVKPSSPARLLKVGAVVLISGAVLLLFGAIGAFYFWKGSDSHIYNVHYTMSINGKLQDGSMEIDAGNNLETFKMGSGAEEAIAVNDFQNGITGIRFAGGEKCYIKAQVKARIPEVGAVTKQSISSKLEGKIMPVKYEENSLIWVAVDQPVKDNSFLSSKVLELCGDLPIFWLKPTYPKEIQRERREVVRKIVPTTTKRPHSGPRSNPGAGRLNNETRPSVQEDSQA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LECT1 (NP_008946.1, 1 a.a. ~ 334 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 11061

Enviar un mensaje


LECT1 MaxPab rabbit polyclonal antibody (D01)

LECT1 MaxPab rabbit polyclonal antibody (D01)