WWP1 monoclonal antibody (M01A), clone 1A7
  • WWP1 monoclonal antibody (M01A), clone 1A7

WWP1 monoclonal antibody (M01A), clone 1A7

Ref: AB-H00011059-M01A
WWP1 monoclonal antibody (M01A), clone 1A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant WWP1.
Información adicional
Size 200 uL
Gene Name WWP1
Gene Alias AIP5|DKFZp434D2111|Tiul1|hSDRP1
Gene Description WW domain containing E3 ubiquitin protein ligase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq CSSSPTIEIQENGDALHENGEPSARTTARLAVEGTNGIDNHVPTSTLVQNSCCSYVVNGDNTPSSPSQVAARPKNTPAPKPLASEPADDTVNGESSSFAPTDNASVTGT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen WWP1 (NP_008944, 152 a.a. ~ 260 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 11059
Clone Number 1A7
Iso type IgG2a Kappa

Enviar un mensaje


WWP1 monoclonal antibody (M01A), clone 1A7

WWP1 monoclonal antibody (M01A), clone 1A7