POLS polyclonal antibody (A01)
  • POLS polyclonal antibody (A01)

POLS polyclonal antibody (A01)

Ref: AB-H00011044-A01
POLS polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant POLS.
Información adicional
Size 50 uL
Gene Name POLS
Gene Alias LAK-1|POLK|TRF4|TRF4-1
Gene Description polymerase (DNA directed) sigma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SPCPEEAAMRREVVKRIETVVKDLWPTADVQIFGSFSTGLYLPTSDIDLVVFGKWERPPLQLLEQALRKHNVAEPCSIKVLDKATVPIIKLTDQETEVKVDISFNMETG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen POLS (NP_008930, 2 a.a. ~ 110 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 11044

Enviar un mensaje


POLS polyclonal antibody (A01)

POLS polyclonal antibody (A01)