RAB31 monoclonal antibody (M03), clone 4D12
  • RAB31 monoclonal antibody (M03), clone 4D12

RAB31 monoclonal antibody (M03), clone 4D12

Ref: AB-H00011031-M03
RAB31 monoclonal antibody (M03), clone 4D12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAB31.
Información adicional
Size 100 ug
Gene Name RAB31
Gene Alias Rab22B
Gene Description RAB31, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA,IF
Immunogen Prot. Seq TLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAESIGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB31 (AAH01148, 96 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11031
Clone Number 4D12
Iso type IgG2a Kappa

Enviar un mensaje


RAB31 monoclonal antibody (M03), clone 4D12

RAB31 monoclonal antibody (M03), clone 4D12