LILRA2 monoclonal antibody (M17), clone 3C7
  • LILRA2 monoclonal antibody (M17), clone 3C7

LILRA2 monoclonal antibody (M17), clone 3C7

Ref: AB-H00011027-M17
LILRA2 monoclonal antibody (M17), clone 3C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant LILRA2.
Información adicional
Size 100 ug
Gene Name LILRA2
Gene Alias CD85H|ILT1|LIR-7|LIR7
Gene Description leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq DRPSLSVQPVPTVAPGKNVTLLCQSRGQFHTFLLTKEGAGHPPLHLRSEHQAQQNQAEFRMG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LILRA2 (NP_006857, 322 a.a. ~ 383 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11027
Clone Number 3C7
Iso type IgG2b Kappa

Enviar un mensaje


LILRA2 monoclonal antibody (M17), clone 3C7

LILRA2 monoclonal antibody (M17), clone 3C7