LILRA2 purified MaxPab mouse polyclonal antibody (B01P)
  • LILRA2 purified MaxPab mouse polyclonal antibody (B01P)

LILRA2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011027-B01P
LILRA2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LILRA2 protein.
Información adicional
Size 50 ug
Gene Name LILRA2
Gene Alias CD85H|ILT1|LIR-7|LIR7
Gene Description leukocyte immunoglobulin-like receptor, subfamily A (with TM domain), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVIIQGSPVTLRCQGSLQAEEYHLYRENKSASWVRRIQEPGKNGQFPIPSITWEHAGRYHCQYYSHNHSSEYSDPLELVVTGAYSKPTLSALPSPVVTLGGNVTLQCVSQVAFDGFILCKEGEDEHPQRLNSHSHARGWSWAIFSVGPVSPSRRWSYRCYAYDSNSPYVWSLPSDLLELLVPGVSKKPSLSVQPGPMVAPGESLTLQCVSDVGYDRFVL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LILRA2 (NP_006857.1, 1 a.a. ~ 466 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11027

Enviar un mensaje


LILRA2 purified MaxPab mouse polyclonal antibody (B01P)

LILRA2 purified MaxPab mouse polyclonal antibody (B01P)