LILRA3 monoclonal antibody (M01), clone 2E9
  • LILRA3 monoclonal antibody (M01), clone 2E9

LILRA3 monoclonal antibody (M01), clone 2E9

Ref: AB-H00011026-M01
LILRA3 monoclonal antibody (M01), clone 2E9

Información del producto

Mouse monoclonal antibody raised against a full length recombinant LILRA3.
Información adicional
Size 100 ug
Gene Name LILRA3
Gene Alias CD85E|HM31|HM43|ILT6|LIR-4|LIR4|e3
Gene Description leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LILRA3 (AAH28208.1, 1 a.a. ~ 439 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11026
Clone Number 2E9
Iso type IgG1 Kappa

Enviar un mensaje


LILRA3 monoclonal antibody (M01), clone 2E9

LILRA3 monoclonal antibody (M01), clone 2E9