LILRA3 purified MaxPab mouse polyclonal antibody (B01P)
  • LILRA3 purified MaxPab mouse polyclonal antibody (B01P)

LILRA3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011026-B01P
LILRA3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LILRA3 protein.
Información adicional
Size 50 ug
Gene Name LILRA3
Gene Alias CD85E|HM31|HM43|ILT6|LIR-4|LIR4|e3
Gene Description leukocyte immunoglobulin-like receptor, subfamily A (without TM domain), member 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTSILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHLYREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTVGLSESSDPLELVVTGAYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRAIFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGEKLTFQCGSDAGYDRF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LILRA3 (NP_006856.2, 1 a.a. ~ 439 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11026

Enviar un mensaje


LILRA3 purified MaxPab mouse polyclonal antibody (B01P)

LILRA3 purified MaxPab mouse polyclonal antibody (B01P)