RABL4 purified MaxPab mouse polyclonal antibody (B01P)
  • RABL4 purified MaxPab mouse polyclonal antibody (B01P)

RABL4 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00011020-B01P
RABL4 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human RABL4 protein.
Información adicional
Size 50 ug
Gene Name RABL4
Gene Alias RAYL
Gene Description RAB, member of RAS oncogene family-like 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RABL4 (AAH00566.1, 1 a.a. ~ 186 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11020

Enviar un mensaje


RABL4 purified MaxPab mouse polyclonal antibody (B01P)

RABL4 purified MaxPab mouse polyclonal antibody (B01P)