IL24 purified MaxPab rabbit polyclonal antibody (D01P)
  • IL24 purified MaxPab rabbit polyclonal antibody (D01P)

IL24 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00011009-D01P
IL24 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human IL24 protein.
Información adicional
Size 100 ug
Gene Name IL24
Gene Alias C49A|FISP|IL-24|IL10B|MDA7|Mob-5|ST16|mda-7
Gene Description interleukin 24
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNFQQRLQSLWTLARPFCPPLLATASQMQMVVLPCLGFTLLLWSQVSGAQGQEFHFGPCQVKGVVPQKLWEAFWAVKDTMQAQDNITSARLLQQEVLQNVSDAESCYLVHTLLEFYLKTVFKNYHNRTVEVRTLKSFSTLANNFVLIVSQLQPSQENEMFSIRDSAHRRFLLFRRAFKQLDVEAALTKALGEVDILLTWMQKFYKL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen IL24 (NP_006841.1, 1 a.a. ~ 206 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 11009

Enviar un mensaje


IL24 purified MaxPab rabbit polyclonal antibody (D01P)

IL24 purified MaxPab rabbit polyclonal antibody (D01P)