SDS purified MaxPab mouse polyclonal antibody (B01P)
  • SDS purified MaxPab mouse polyclonal antibody (B01P)

SDS purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010993-B01P
SDS purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SDS protein.
Información adicional
Size 50 ug
Gene Name SDS
Gene Alias SDH
Gene Description serine dehydratase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MMSGEPLHVKTPIRDSMALSKMAGTSVYLKMDSAQPSGSFKIRGIGHFCKRWAKQGCAHFVCSSAGNAGMAAAYAARQLGVPATIVVPSTTPALTIERLKNEGATVKVVGELLDEAFELAKALAKNNPGWVYIPPFDDPLIWEGHASIVKELKETLWEKPGAIALSVGGGGLLCGVVQGLQEVGWGDVPVIAMETFGAHSFHAATTAGKLVSLPKITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SDS (NP_006834.2, 1 a.a. ~ 328 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10993

Enviar un mensaje


SDS purified MaxPab mouse polyclonal antibody (B01P)

SDS purified MaxPab mouse polyclonal antibody (B01P)