COPS5 polyclonal antibody (A01)
  • COPS5 polyclonal antibody (A01)

COPS5 polyclonal antibody (A01)

Ref: AB-H00010987-A01
COPS5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant COPS5.
Información adicional
Size 50 uL
Gene Name COPS5
Gene Alias CSN5|JAB1|MGC3149|MOV-34|SGN5
Gene Description COP9 constitutive photomorphogenic homolog subunit 5 (Arabidopsis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MAASGSGMAQKTWELANNMQEAQSIDEIYKYDKKQQQEILAAKPWTKDHHYFKYCKISALALLKMVMHARSGGNLEVMGLMLGKVDGETMIIMDSFALPVEGTETRVNAQAAAYEYMAAYIENAKQVGRLENAIGWYHSHPGYGCWLSGIDVSTQMLNQQFQEPFVAVVIDPTRTISAGKVNLGAFRTYPKGYKPPDEGPSEYQTIPLNKIEDFGVHCKQYYALEVSYFKSSLDRKLLELLWNKYWVNTLSSSSL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen COPS5 (AAH01187.1, 1 a.a. ~ 334 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10987

Enviar un mensaje


COPS5 polyclonal antibody (A01)

COPS5 polyclonal antibody (A01)