Ver mas grande
MAPRE2 MaxPab rabbit polyclonal antibody (D01)
AB-H00010982-D01
Producto nuevo
MAPRE2 MaxPab rabbit polyclonal antibody (D01)
Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.
Hoja técnica
| Size | 100 uL |
| Gene Name | MAPRE2 |
| Gene Alias | EB1|EB2|RP1 |
| Gene Description | microtubule-associated protein, RP/EB family, member 2 |
| Storage Conditions | Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing. |
| Application Key | IP |
| Immunogen Prot. Seq | MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLK |
| Antigen species Target species | Human |
| Quality control testing | Antibody reactive against mammalian transfected lysate. |
| Immunogen | MAPRE2 (NP_055083.1, 1 a.a. ~ 327 a.a) full-length human protein. |
| Storage Buffer | No additive |
| Gene ID | 10982 |
Más información
Rabbit polyclonal antibody raised against a full-length human MAPRE2 protein.