MAPRE2 MaxPab rabbit polyclonal antibody (D01)
  • MAPRE2 MaxPab rabbit polyclonal antibody (D01)

MAPRE2 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010982-D01
MAPRE2 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human MAPRE2 protein.
Información adicional
Size 100 uL
Gene Name MAPRE2
Gene Alias EB1|EB2|RP1
Gene Description microtubule-associated protein, RP/EB family, member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MPGPTQTLSPNGENNNDIIQDNNGTIIPFRKHTVRGERSYSWGMAVNVYSTSITQETMSRHDIIAWVNDIVSLNYTKVEQLCSGAAYCQFMDMLFPGCISLKKVKFQAKLEHEYIHNFKLLQASFKRMNVDKVIPVEKLVKGRFQDNLDFIQWFKKFYDANYDGKEYDPVEARQGQDAIPPPDPGEQIFNLPKKSHHANSPTAGAAKSSPAAKPGSTPSRPSSAKRASSSGSASKSDKDLETQVIQLNEQVHSLK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MAPRE2 (NP_055083.1, 1 a.a. ~ 327 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10982

Enviar un mensaje


MAPRE2 MaxPab rabbit polyclonal antibody (D01)

MAPRE2 MaxPab rabbit polyclonal antibody (D01)