RAB32 monoclonal antibody (M01), clone 1C7
  • RAB32 monoclonal antibody (M01), clone 1C7

RAB32 monoclonal antibody (M01), clone 1C7

Ref: AB-H00010981-M01
RAB32 monoclonal antibody (M01), clone 1C7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAB32.
Información adicional
Size 100 ug
Gene Name RAB32
Gene Alias -
Gene Description RAB32, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,S-ELISA,ELISA
Immunogen Prot. Seq IPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB32 (NP_006825, 136 a.a. ~ 225 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10981
Clone Number 1C7
Iso type IgG2a Kappa

Enviar un mensaje


RAB32 monoclonal antibody (M01), clone 1C7

RAB32 monoclonal antibody (M01), clone 1C7