RAB32 purified MaxPab rabbit polyclonal antibody (D01P)
  • RAB32 purified MaxPab rabbit polyclonal antibody (D01P)

RAB32 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010981-D01P
RAB32 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RAB32 protein.
Información adicional
Size 100 ug
Gene Name RAB32
Gene Alias -
Gene Description RAB32, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr
Immunogen Prot. Seq MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RAB32 (NP_006825.1, 1 a.a. ~ 225 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10981

Enviar un mensaje


RAB32 purified MaxPab rabbit polyclonal antibody (D01P)

RAB32 purified MaxPab rabbit polyclonal antibody (D01P)