RAB40B monoclonal antibody (M01A), clone 1A1
  • RAB40B monoclonal antibody (M01A), clone 1A1

RAB40B monoclonal antibody (M01A), clone 1A1

Ref: AB-H00010966-M01A
RAB40B monoclonal antibody (M01A), clone 1A1

Información del producto

Mouse monoclonal antibody raised against a partial recombinant RAB40B.
Información adicional
Size 200 uL
Gene Name RAB40B
Gene Alias FLJ42385|RAR|SEC4L
Gene Description RAB40B, member RAS oncogene family
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq GMDRLWRPSKVLSLQDLCCRAVVSCTPVHLVDKLPLPIALRSHLKSFSMANGLNARMMHGGSYSLTTSSTHKRSSLRKVKLVRPPQSPPKNCTRNSCKIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen RAB40B (AAH18039, 179 a.a. ~ 278 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 10966
Clone Number 1A1
Iso type IgG1 Kappa

Enviar un mensaje


RAB40B monoclonal antibody (M01A), clone 1A1

RAB40B monoclonal antibody (M01A), clone 1A1