PDIA5 polyclonal antibody (A01)
  • PDIA5 polyclonal antibody (A01)

PDIA5 polyclonal antibody (A01)

Ref: AB-H00010954-A01
PDIA5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDIA5.
Información adicional
Size 50 uL
Gene Name PDIA5
Gene Alias FLJ30401|PDIR
Gene Description protein disulfide isomerase family A, member 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ERISDPKDLKKLLRTRNNVLVLYSKSEVAAENHLRLLSTVAQAVKGQGTICWVDCGDAESRKLCKKMKVDLSPKDKKVELFHYQDGAFHTEYNRAVTFKS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDIA5 (NP_006801, 31 a.a. ~ 130 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10954

Enviar un mensaje


PDIA5 polyclonal antibody (A01)

PDIA5 polyclonal antibody (A01)