TOMM34 monoclonal antibody (M02), clone 1D2
  • TOMM34 monoclonal antibody (M02), clone 1D2

TOMM34 monoclonal antibody (M02), clone 1D2

Ref: AB-H00010953-M02
TOMM34 monoclonal antibody (M02), clone 1D2

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant TOMM34.
Información adicional
Size 100 ug
Gene Name TOMM34
Gene Alias HTOM34P|TOM34|URCC3
Gene Description translocase of outer mitochondrial membrane 34
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,IP,ELISA
Immunogen Prot. Seq MAPKFPDSVEELRAAGNESFRNGQYAEASALYGRALRVLQAQGSSDPEEESVLYSNRAACHLKDGNCRDCIKDCTSALALVPFSIKPLLRRASAYEALEKYPMAYVDYKTVLQIDDNVTSAVEGINRMTRALMDSLGPEWRLKLPSIPLVPVSAQKRWNSLPSENHKEMAKSKSKETTATKNRVPSAGDVEKARVLKEEGNELVKKGNHKKAIEKYSESLLCSNLESATYSNRALCYLVLKQYTEAVKDCTEALK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen TOMM34 (AAH01763, 1 a.a. ~ 309 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10953
Clone Number 1D2
Iso type IgG2a Kappa

Enviar un mensaje


TOMM34 monoclonal antibody (M02), clone 1D2

TOMM34 monoclonal antibody (M02), clone 1D2