SEC61B purified MaxPab rabbit polyclonal antibody (D01P)
  • SEC61B purified MaxPab rabbit polyclonal antibody (D01P)

SEC61B purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010952-D01P
SEC61B purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SEC61B protein.
Información adicional
Size 100 ug
Gene Name SEC61B
Gene Alias -
Gene Description Sec61 beta subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPGPTPSGTNVGSSGRSPSKAVAARAAGSTVRQRKNASCGTRSAGRTTSAGTGGMWRFYTEDSPGLKVGPVPVLVMSLLFIASVFMLHIWGKYTRS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SEC61B (NP_006799.1, 1 a.a. ~ 96 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10952

Enviar un mensaje


SEC61B purified MaxPab rabbit polyclonal antibody (D01P)

SEC61B purified MaxPab rabbit polyclonal antibody (D01P)