AP3M2 purified MaxPab mouse polyclonal antibody (B01P)
  • AP3M2 purified MaxPab mouse polyclonal antibody (B01P)

AP3M2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010947-B01P
AP3M2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human AP3M2 protein.
Información adicional
Size 50 ug
Gene Name AP3M2
Gene Alias AP47B|CLA20|P47B
Gene Description adaptor-related protein complex 3, mu 2 subunit
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MIHSLFLINSSGDIFLEKHWKSVVSRSVCDYFFEAQERATEAENVPPVIPTPHHYLLSVYRHKIFFVAVIQTEVPPLFVIEFLHRVVDTFQDYFGVCSEPVIKDNVVVVYEVLEEMLDNGFPLATESNILKELIKPPTILRTVVNTITGSTNVGDQLPTGQLSVVPWRRTGVKYTNNEAYFDVIEEIDAIIDKSGSTITAEIQGVIDACVKLTGMPDLTLSFMNPRLLDDVSFHPCVRFKRWESERILSFIPPDG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen AP3M2 (NP_006794.1, 1 a.a. ~ 418 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10947

Enviar un mensaje


AP3M2 purified MaxPab mouse polyclonal antibody (B01P)

AP3M2 purified MaxPab mouse polyclonal antibody (B01P)