RALBP1 purified MaxPab rabbit polyclonal antibody (D01P)
  • RALBP1 purified MaxPab rabbit polyclonal antibody (D01P)

RALBP1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010928-D01P
RALBP1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human RALBP1 protein.
Información adicional
Size 100 ug
Gene Name RALBP1
Gene Alias RIP1|RLIP1|RLIP76
Gene Description ralA binding protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr,PLA-Ce
Immunogen Prot. Seq MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen RALBP1 (NP_006779.1, 1 a.a. ~ 655 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10928

Enviar un mensaje


RALBP1 purified MaxPab rabbit polyclonal antibody (D01P)

RALBP1 purified MaxPab rabbit polyclonal antibody (D01P)