FASTK monoclonal antibody (M02), clone 2B7
  • FASTK monoclonal antibody (M02), clone 2B7

FASTK monoclonal antibody (M02), clone 2B7

Ref: AB-H00010922-M02
FASTK monoclonal antibody (M02), clone 2B7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FASTK.
Información adicional
Size 100 ug
Gene Name FASTK
Gene Alias FAST
Gene Description Fas-activated serine/threonine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA,IF
Immunogen Prot. Seq KWGDRPVGGGPSAGPVQGLQRLLEQAKSPGELLRWLGQNPSKVRAHHYSVALRRLGQLLGSRPRPPPVEQVTLQDLSQLIIRNCPSFD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FASTK (NP_006703, 67 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10922
Clone Number 2B7
Iso type IgG2a Kappa

Enviar un mensaje


FASTK monoclonal antibody (M02), clone 2B7

FASTK monoclonal antibody (M02), clone 2B7