FASTK purified MaxPab rabbit polyclonal antibody (D01P)
  • FASTK purified MaxPab rabbit polyclonal antibody (D01P)

FASTK purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010922-D01P
FASTK purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FASTK protein.
Información adicional
Size 100 ug
Gene Name FASTK
Gene Alias FAST
Gene Description Fas-activated serine/threonine kinase
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MRRPRGEPGPRAPRPTEGATCAGPGESWSPSPNSMLRVLLSAQTSPARLSGLLLIPPVQPCCLGPSKWGDRPVGGGPSAGPVQGLQRLLEQAKSPGELLRWLGQNPSKVRAHHYSVALRRLGQLLGSRPRPPPVEQVTLQDLSQLIIRNCPSFDIHTIHVCLHLAVLLGFPSDGPLVCALEQERRLRLPPKPPPPLQPLLRGGQGLEAALSCPRFLRYPRQHLISSLAEARPEELTPHVMVLLAQHLARHRLREP
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FASTK (NP_006703.1, 1 a.a. ~ 549 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10922

Enviar un mensaje


FASTK purified MaxPab rabbit polyclonal antibody (D01P)

FASTK purified MaxPab rabbit polyclonal antibody (D01P)