COPS8 purified MaxPab mouse polyclonal antibody (B01P)
  • COPS8 purified MaxPab mouse polyclonal antibody (B01P)

COPS8 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010920-B01P
COPS8 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human COPS8 protein.
Información adicional
Size 50 ug
Gene Name COPS8
Gene Alias COP9|CSN8|MGC1297|MGC43256|SGN8
Gene Description COP9 constitutive photomorphogenic homolog subunit 8 (Arabidopsis)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MPVAVMAESAFSFKKLLDQCENQELEAPGGIATPPVYGQLLALYLLHNDMNNARYLWKRIPPAIKSANSELGGIWSVGQRIWQRDFPGIYTTINAHQWSETVQPIMEALRDATRRRAFALVSQAYTSIIADDFAAFVGLPVEEAVKGILEQGWQADSTTRMVLPRKPVAGALDVSFNKFIPLSEPAPVPPIPNEQQLARLTDYVAFLEN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen COPS8 (AAH03090, 1 a.a. ~ 209 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10920

Enviar un mensaje


COPS8 purified MaxPab mouse polyclonal antibody (B01P)

COPS8 purified MaxPab mouse polyclonal antibody (B01P)