EDAR monoclonal antibody (M02A), clone 3A7
  • EDAR monoclonal antibody (M02A), clone 3A7

EDAR monoclonal antibody (M02A), clone 3A7

Ref: AB-H00010913-M02A
EDAR monoclonal antibody (M02A), clone 3A7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant EDAR.
Información adicional
Size 200 uL
Gene Name EDAR
Gene Alias DL|ED1R|ED3|ED5|EDA-A1R|EDA1R|EDA3|FLJ94390
Gene Description ectodysplasin A receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EDAR (NP_071731, 64 a.a. ~ 178 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 10913
Clone Number 3A7
Iso type IgG2b Kappa

Enviar un mensaje


EDAR monoclonal antibody (M02A), clone 3A7

EDAR monoclonal antibody (M02A), clone 3A7