EDAR polyclonal antibody (A01)
  • EDAR polyclonal antibody (A01)

EDAR polyclonal antibody (A01)

Ref: AB-H00010913-A01
EDAR polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant EDAR.
Información adicional
Size 50 uL
Gene Name EDAR
Gene Alias DL|ED1R|ED3|ED5|EDA-A1R|EDA1R|EDA3|FLJ94390
Gene Description ectodysplasin A receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq TKDEDYGCVPCPAEKFSKGGYQICRRHKDCEGFFRATVLTPGDMENDAECGPCLPGYYMLENRPRNIYGMVCYSCLLAPPNTKECVGATSGASANFPGTSGSSTLSPFQHAHKEL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen EDAR (NP_071731, 64 a.a. ~ 178 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10913

Enviar un mensaje


EDAR polyclonal antibody (A01)

EDAR polyclonal antibody (A01)