GADD45G monoclonal antibody (M01A), clone 1D3
  • GADD45G monoclonal antibody (M01A), clone 1D3

GADD45G monoclonal antibody (M01A), clone 1D3

Ref: AB-H00010912-M01A
GADD45G monoclonal antibody (M01A), clone 1D3

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant GADD45G.
Información adicional
Size 200 uL
Gene Name GADD45G
Gene Alias CR6|DDIT2|GADD45gamma|GRP17
Gene Description growth arrest and DNA-damage-inducible, gamma
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTLEEVRGQDTVPESTARMQGAGKALHELLLSAQRQGCLTAGVYESAKVLNVDPDNVTFCVLAAGEEDEGDIALQIHFTLIQAFCCENDIDIVRVGDVQRLAAIVGAGEEAGAPGDLHCILISNPNEDAWKDPALEKLSLFCEESRSVNDWVPSITLPE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen GADD45G (AAH19325, 1 a.a. ~ 159 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 10912
Clone Number 1D3
Iso type IgG2a Kappa

Enviar un mensaje


GADD45G monoclonal antibody (M01A), clone 1D3

GADD45G monoclonal antibody (M01A), clone 1D3