SUGT1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SUGT1 purified MaxPab rabbit polyclonal antibody (D01P)

SUGT1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010910-D01P
SUGT1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SUGT1 protein.
Información adicional
Size 100 ug
Gene Name SUGT1
Gene Alias SGT1
Gene Description SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKKSLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNW
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SUGT1 (NP_006695.1, 1 a.a. ~ 333 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10910

Enviar un mensaje


SUGT1 purified MaxPab rabbit polyclonal antibody (D01P)

SUGT1 purified MaxPab rabbit polyclonal antibody (D01P)