SUGT1 polyclonal antibody (A03)
  • SUGT1 polyclonal antibody (A03)

SUGT1 polyclonal antibody (A03)

Ref: AB-H00010910-A03
SUGT1 polyclonal antibody (A03)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant SUGT1.
Información adicional
Size 50 uL
Gene Name SUGT1
Gene Alias SGT1
Gene Description SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SUGT1 (NP_006695, 151 a.a. ~ 260 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10910

Enviar un mensaje


SUGT1 polyclonal antibody (A03)

SUGT1 polyclonal antibody (A03)