CPSF4 purified MaxPab mouse polyclonal antibody (B02P)
  • CPSF4 purified MaxPab mouse polyclonal antibody (B02P)

CPSF4 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00010898-B02P
CPSF4 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human CPSF4 protein.
Información adicional
Size 50 ug
Gene Name CPSF4
Gene Alias CPSF30|NAR|NEB1
Gene Description cleavage and polyadenylation specific factor 4, 30kDa
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQEIIASVDHIKFDLEIAVEQQLGAQPLPFPGMDKSGAAVCEFFLKAACGKGGMCPFRHISGEKTVVCKHWLRGLCKKGDQCEFLHEYDMTKMPECYFYSKFGECSNKECPFLHIDPESKIKDCPWYDRGFCKHGPLCRHRHTRRVICVNYLVGFCPEGPSCKFMHPRFELPMGTTEQPPLPQQTQPPAKRTPQVIGVMQSQNSSAGNRGPRPLEQVTCYKCGEKGHYANRCTKGHLAFLSGQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen CPSF4 (AAH50738.1, 1 a.a. ~ 243 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10898

Enviar un mensaje


CPSF4 purified MaxPab mouse polyclonal antibody (B02P)

CPSF4 purified MaxPab mouse polyclonal antibody (B02P)