MALT1 purified MaxPab mouse polyclonal antibody (B01P)
  • MALT1 purified MaxPab mouse polyclonal antibody (B01P)

MALT1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010892-B01P
MALT1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human MALT1 protein.
Información adicional
Size 50 ug
Gene Name MALT1
Gene Alias DKFZp434L132|MLT|MLT1
Gene Description mucosa associated lymphoid tissue lymphoma translocation gene 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSLLGDPLQALPPSAAPTGPLLAPPAGATLNRLREPLLRRLSELLDQAPEGRGWRRLAELAGSRGRLRLSCLDLEQCSLKVLEPEGSPSLCLLKLMGEKGCTVTELSDFLQAMEHTEVLQLLSPPGIKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen MALT1 (NP_776216.1, 1 a.a. ~ 813 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10892

Enviar un mensaje


MALT1 purified MaxPab mouse polyclonal antibody (B01P)

MALT1 purified MaxPab mouse polyclonal antibody (B01P)