PPARGC1A monoclonal antibody (M11), clone 2E11
  • PPARGC1A monoclonal antibody (M11), clone 2E11

PPARGC1A monoclonal antibody (M11), clone 2E11

Ref: AB-H00010891-M11
PPARGC1A monoclonal antibody (M11), clone 2E11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPARGC1A.
Información adicional
Size 100 ug
Gene Name PPARGC1A
Gene Alias LEM6|PGC-1(alpha)|PGC-1v|PGC1|PGC1A|PPARGC1
Gene Description peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10891
Clone Number 2E11
Iso type IgG2a Kappa

Enviar un mensaje


PPARGC1A monoclonal antibody (M11), clone 2E11

PPARGC1A monoclonal antibody (M11), clone 2E11