PPARGC1A monoclonal antibody (M01), clone 4A8
  • PPARGC1A monoclonal antibody (M01), clone 4A8

PPARGC1A monoclonal antibody (M01), clone 4A8

Ref: AB-H00010891-M01
PPARGC1A monoclonal antibody (M01), clone 4A8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PPARGC1A.
Información adicional
Size 100 ug
Gene Name PPARGC1A
Gene Alias LEM6|PGC-1(alpha)|PGC-1v|PGC1|PGC1A|PPARGC1
Gene Description peroxisome proliferator-activated receptor gamma, coactivator 1 alpha
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq TRTELRDRFEVFGEIEECTVNLRDDGDSYGFITYRYTCDAFAALENGYTLRRSNETDFELYFCGRKQFFKSNYADLDSNSDDFDPASTKSKYDSLDFDSLLKEAQRSLRR
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PPARGC1A (NP_037393, 689 a.a. ~ 798 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10891
Clone Number 4A8
Iso type IgG2b Kappa

Enviar un mensaje


PPARGC1A monoclonal antibody (M01), clone 4A8

PPARGC1A monoclonal antibody (M01), clone 4A8