ACTL7B monoclonal antibody (M01), clone 6A4
  • ACTL7B monoclonal antibody (M01), clone 6A4

ACTL7B monoclonal antibody (M01), clone 6A4

Ref: AB-H00010880-M01
ACTL7B monoclonal antibody (M01), clone 6A4

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ACTL7B.
Información adicional
Size 100 ug
Gene Name ACTL7B
Gene Alias -
Gene Description actin-like 7B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq GKLITIGQERFRCSEMLFQPSLAGSTQPGLPELTAACLGRCQDTGFKEEMAANVLLCGGCTMLDGFPERFQRELSLLCPGDSPAVAAAPERK
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ACTL7B (NP_006677, 286 a.a. ~ 377 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10880
Clone Number 6A4
Iso type IgG2a Kappa

Enviar un mensaje


ACTL7B monoclonal antibody (M01), clone 6A4

ACTL7B monoclonal antibody (M01), clone 6A4