ACTL7B MaxPab rabbit polyclonal antibody (D01)
  • ACTL7B MaxPab rabbit polyclonal antibody (D01)

ACTL7B MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010880-D01
ACTL7B MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human ACTL7B protein.
Información adicional
Size 100 uL
Gene Name ACTL7B
Gene Alias -
Gene Description actin-like 7B
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IP
Immunogen Prot. Seq MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAGHAFTDDHLHIIEHI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen ACTL7B (NP_006677.1, 1 a.a. ~ 415 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10880

Enviar un mensaje


ACTL7B MaxPab rabbit polyclonal antibody (D01)

ACTL7B MaxPab rabbit polyclonal antibody (D01)