Idioma:
Español
Español
Português
Español
Português
Buscar
Iniciar sesión
REACTIVOS
INSTRUMENTOS
CONSUMIBLES
OFERTAS
DESTACADOS
FABRICANTES
PUBLICACIONES CIENTÍFICAS
DESCARGAS
NEWSLETTERS
BIOGEN Científica
Reactivos
ABNOVA
Antibody
ACTL7B purified MaxPab mouse polyclonal antibody (B01P)
Abnova
ACTL7B purified MaxPab mouse polyclonal antibody (B01P)
Ref: AB-H00010880-B01P
ACTL7B purified MaxPab mouse polyclonal antibody (B01P)
Contáctenos
Información del producto
Mouse polyclonal antibody raised against a full-length human ACTL7B protein.
Información adicional
Size
50 ug
Gene Name
ACTL7B
Gene Alias
-
Gene Description
actin-like 7B
Storage Conditions
Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key
WB-Tr
Immunogen Prot. Seq
MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTLVGHELLNTEAPLKLVNPLKHGIVVDWDCVQDIWEYIFRTAMKILPEEHAVLVSDPPLSPSSNREKYAELMFETFGIPAMHVTSQSLLSIYSYGKTSGLVVESGHGVSHVVPISEGDVLPGLTSRADYAGGDLTNYLMQLLNEAGHAFTDDHLHIIEHI
Antigen species Target species
Human
Quality control testing
Antibody reactive against mammalian transfected lysate.
Immunogen
ACTL7B (NP_006677.1, 1 a.a. ~ 415 a.a) full-length human protein.
Storage Buffer
In 1x PBS, pH 7.4
Gene ID
10880
Enviar un mensaje
ACTL7B purified MaxPab mouse polyclonal antibody (B01P)
Nombre
*
Apellidos
*
Correo electrónico
*
Centro de Investigación
*
Departamento
Teléfono de Contacto
*
Mensaje de consulta sobre el producto
*