FAM12A monoclonal antibody (M01), clone 3D9
  • FAM12A monoclonal antibody (M01), clone 3D9

FAM12A monoclonal antibody (M01), clone 3D9

Ref: AB-H00010876-M01
FAM12A monoclonal antibody (M01), clone 3D9

Información del producto

Mouse monoclonal antibody raised against a full-length recombinant FAM12A.
Información adicional
Size 100 ug
Gene Name FAM12A
Gene Alias EP3A|HE3-ALPHA|HE3A|HE3ALPHA|MGC119614|MGC119615
Gene Description family with sequence similarity 12, member A
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MTSSLKIWGILLALLCILCRLCVYSNNIYWREFIKLHYLSPSREFKEYKCDVLMREKEALKGKSFHMFIYSLWFKIQRACINEKGSDRYRNAYVWAPGALKVLECHWEKYNNRYTESRSFSYIEFHCGVDGYVDNIEDLRIIEPISN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FAM12A (NP_006674.2, 1 a.a. ~ 147 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10876
Clone Number 3D9
Iso type IgG1 Kappa

Enviar un mensaje


FAM12A monoclonal antibody (M01), clone 3D9

FAM12A monoclonal antibody (M01), clone 3D9