FGL2 monoclonal antibody (M02), clone 5A10
  • FGL2 monoclonal antibody (M02), clone 5A10

FGL2 monoclonal antibody (M02), clone 5A10

Ref: AB-H00010875-M02
FGL2 monoclonal antibody (M02), clone 5A10

Información del producto

Mouse monoclonal antibody raised against a partial recombinant FGL2.
Información adicional
Size 100 ug
Gene Name FGL2
Gene Alias T49|pT49
Gene Description fibrinogen-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq NNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPG
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen FGL2 (NP_006673, 24 a.a. ~ 123 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10875
Clone Number 5A10
Iso type IgG1 Kappa

Enviar un mensaje


FGL2 monoclonal antibody (M02), clone 5A10

FGL2 monoclonal antibody (M02), clone 5A10