FGL2 purified MaxPab rabbit polyclonal antibody (D01P)
  • FGL2 purified MaxPab rabbit polyclonal antibody (D01P)

FGL2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010875-D01P
FGL2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human FGL2 protein.
Información adicional
Size 100 ug
Gene Name FGL2
Gene Alias T49|pT49
Gene Description fibrinogen-like 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MKLANWYWLSSAVLATYGFLVVANNETEEIKDERAKDVCPVRLESRGKCEEAGECPYQVSLPPLTIQLPKQFSRIEEVFKEVQNLKEIVNSLKKSCQDCKLQADDNGDPGRNGLLLPSTGAPGEVGDNRVRELESEVNKLSSELKNAKEEINVLHGRLEKLNLVNMNNIENYVDSKVANLTFVVNSLDGKCSKCPSQEQIQSRPVQHLIYKDCSDYYAIGKRSSETYRVTPDPKNSSFEVYCDMETMGGGWTVLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen FGL2 (NP_006673.1, 1 a.a. ~ 439 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10875

Enviar un mensaje


FGL2 purified MaxPab rabbit polyclonal antibody (D01P)

FGL2 purified MaxPab rabbit polyclonal antibody (D01P)