NMU purified MaxPab rabbit polyclonal antibody (D01P)
  • NMU purified MaxPab rabbit polyclonal antibody (D01P)

NMU purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00010874-D01P
NMU purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human NMU protein.
Información adicional
Size 100 ug
Gene Name NMU
Gene Alias -
Gene Description neuromedin U
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen NMU (NP_006672.1, 1 a.a. ~ 174 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10874

Enviar un mensaje


NMU purified MaxPab rabbit polyclonal antibody (D01P)

NMU purified MaxPab rabbit polyclonal antibody (D01P)