USP19 purified MaxPab mouse polyclonal antibody (B01P)
  • USP19 purified MaxPab mouse polyclonal antibody (B01P)

USP19 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010869-B01P
USP19 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human USP19 protein.
Información adicional
Size 50 ug
Gene Name USP19
Gene Alias ZMYND9
Gene Description ubiquitin specific peptidase 19
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MSGGASATGPRRGPPGLEDTTSKKKQKDRANQESKDGDPRKETGSRYVAQAGLEPLASGDPSASASHAAGITGSRHRTRLFFPSSSGSASTPQEEQTKEGACEDPHDLLATPTPELLLDWRQSAEEVIVKLRVGVGPLQLEDVDAAFTDTDCVVRFAGGQQWGGVFYAEIKSSCAKVQTRKGSLLHLTLPKKVPMLTWPSLLVEADEQLCIPPLNSQTCLLGSEENLAPLAGEKAVPPGNDPVSPAMVRSRNPGK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen USP19 (NP_006668.1, 1 a.a. ~ 1318 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10869

Enviar un mensaje


USP19 purified MaxPab mouse polyclonal antibody (B01P)

USP19 purified MaxPab mouse polyclonal antibody (B01P)