USP20 monoclonal antibody (M01), clone 1A6
  • USP20 monoclonal antibody (M01), clone 1A6

USP20 monoclonal antibody (M01), clone 1A6

Ref: AB-H00010868-M01
USP20 monoclonal antibody (M01), clone 1A6

Información del producto

Mouse monoclonal antibody raised against a partial recombinant USP20.
Información adicional
Size 100 ug
Gene Name USP20
Gene Alias KIAA1003|LSFR3A|VDU2
Gene Description ubiquitin specific peptidase 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDAD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP20 (NP_001008563, 252 a.a. ~ 349 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10868
Clone Number 1A6
Iso type IgG1 Kappa

Enviar un mensaje


USP20 monoclonal antibody (M01), clone 1A6

USP20 monoclonal antibody (M01), clone 1A6