USP20 MaxPab rabbit polyclonal antibody (D01)
  • USP20 MaxPab rabbit polyclonal antibody (D01)

USP20 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00010868-D01
USP20 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human USP20 protein.
Información adicional
Size 100 uL
Gene Name USP20
Gene Alias KIAA1003|LSFR3A|VDU2
Gene Description ubiquitin specific peptidase 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MGDSRDLCPHLDSIGEVTKEDLLLKSKGTCQSCGVTGPNLWACLQVACPYVGCGESFADHSTIHAQAKKHNLTVNLTTFRLWCYACEKEVFLEQRLAAPLLGSSSKFSEQDSPPPSHPLKAVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLVRTDKKPALCKSYQKLVSEVWHKKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLMDQLHEELKEPVVATV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen USP20 (NP_001008563.1, 1 a.a. ~ 913 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 10868

Enviar un mensaje


USP20 MaxPab rabbit polyclonal antibody (D01)

USP20 MaxPab rabbit polyclonal antibody (D01)