USP20 polyclonal antibody (A01)
  • USP20 polyclonal antibody (A01)

USP20 polyclonal antibody (A01)

Ref: AB-H00010868-A01
USP20 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant USP20.
Información adicional
Size 50 uL
Gene Name USP20
Gene Alias KIAA1003|LSFR3A|VDU2
Gene Description ubiquitin specific peptidase 20
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq VATVALTEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQGRGGGSSQAETELLIPDEAGRAISEKERMKDRKFSWGQQRTNSEQVDEDAD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen USP20 (NP_001008563, 252 a.a. ~ 349 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10868

Enviar un mensaje


USP20 polyclonal antibody (A01)

USP20 polyclonal antibody (A01)