HCP5 polyclonal antibody (A01)
  • HCP5 polyclonal antibody (A01)

HCP5 polyclonal antibody (A01)

Ref: AB-H00010866-A01
HCP5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant HCP5.
Información adicional
Size 50 uL
Gene Name HCP5
Gene Alias D6S2650E|P5-1
Gene Description HLA complex P5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq LRMSEHRNEALGNYLEMRLKSSFLRGLGSWKSNPLRLGGWTILLTLTMGQGEPGGPQGDPWVPHELLLPSLCDSSHASSWGSGSITCAWRGGDSSSHPLVS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen HCP5 (NP_006665, 3 a.a. ~ 103 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 10866

Enviar un mensaje


HCP5 polyclonal antibody (A01)

HCP5 polyclonal antibody (A01)