LILRB1 monoclonal antibody (M01), clone 3D3-1D12
  • LILRB1 monoclonal antibody (M01), clone 3D3-1D12

LILRB1 monoclonal antibody (M01), clone 3D3-1D12

Ref: AB-H00010859-M01
LILRB1 monoclonal antibody (M01), clone 3D3-1D12

Información del producto

Mouse monoclonal antibody raised against a full length recombinant LILRB1.
Información adicional
Size 100 ug
Gene Name LILRB1
Gene Alias CD85|CD85J|FLJ37515|ILT2|LIR-1|LIR1|MIR-7|MIR7
Gene Description leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq RTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRFVLYKDGERDFLQLAGAQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen LILRB1 (AAH15731, 18 a.a. ~ 650 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10859
Clone Number 3D3-1D12
Iso type IgG1 kappa

Enviar un mensaje


LILRB1 monoclonal antibody (M01), clone 3D3-1D12

LILRB1 monoclonal antibody (M01), clone 3D3-1D12