LILRB1 purified MaxPab mouse polyclonal antibody (B01P)
  • LILRB1 purified MaxPab mouse polyclonal antibody (B01P)

LILRB1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00010859-B01P
LILRB1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human LILRB1 protein.
Información adicional
Size 50 ug
Gene Name LILRB1
Gene Alias CD85|CD85J|FLJ37515|ILT2|LIR-1|LIR1|MIR-7|MIR7
Gene Description leukocyte immunoglobulin-like receptor, subfamily B (with TM and ITIM domains), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MTPILTVLICLGLSLGPRTHVQAGHLPKPTLWAEPGSVITQGSPVTLRCQGGQETQEYRLYREKKTAPWITRIPQELVKKGQFPIPSITWEHAGRYRCYYGSDTAGRSESSDPLELVVTGAYIKPTLSAQPSPVVNSGGNVTLQCDSQVAFDGFILCKEGEDEHPQCLNSQPHARGSSRAIFSVGPVSPSRRWWYRCYAYDSNSPYEWSLPSDLLELLVLGVSKKPSLSVQPGPIVAPEETLTLQCGSDAGYNRF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen LILRB1 (AAH15731.1, 1 a.a. ~ 650 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 10859

Enviar un mensaje


LILRB1 purified MaxPab mouse polyclonal antibody (B01P)

LILRB1 purified MaxPab mouse polyclonal antibody (B01P)